PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_37364.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 391aa    MW: 43301.4 Da    PI: 9.6108
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_37364.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM156.79.6e-49441702128
           NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                   +pGfrFhPt+eel+ +yL++kv+gk++++ + i++vd+y+++PwdLp+ ++ ++kew+f+++rd+ky++g+r+nr+t sgyWkatg d+ v++  ++
  MLOC_37364.1  44 MPGFRFHPTEEELIEFYLRRKVDGKRFNI-DLIASVDLYRYDPWDLPALASIGDKEWFFYVPRDRKYRNGDRPNRVTPSGYWKATGADRMVKVVeGN 139
                   79***************************.99***************888889************************************99887578 PP

           NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                   + +glkktLvfy g+apkg +++W+m+eyrl
  MLOC_37364.1 140 RSIGLKKTLVFYVGKAPKGLRSSWIMNEYRL 170
                   88***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100556.07443190IPR003441NAC domain
SuperFamilySSF1019411.01E-5643190IPR003441NAC domain
PfamPF023652.1E-2445170IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MTRSRPTTTM GGSVPDHHHQ QQQHDGEVDG GQLQHGGEHV ETVMPGFRFH PTEEELIEFY  60
LRRKVDGKRF NIDLIASVDL YRYDPWDLPA LASIGDKEWF FYVPRDRKYR NGDRPNRVTP  120
SGYWKATGAD RMVKVVEGNR SIGLKKTLVF YVGKAPKGLR SSWIMNEYRL PHGETERYQK  180
EISLCRVYKR PGIDDNFHLT GTTTRSSGSR AAATRHSTAA HRTSAVATHR QQPPVFVEGA  240
GHHSSSALKA YNAHTTQGTN AASTMTSLSA AGVTPPAMFR STASVASLSS TNSTEEDGTS  300
LYHHHLKGHN NPAVMQLHSS THAALLNTNS SAMATIPIDE LSRAIGSYSQ ASNPNQPTAP  360
MQGPLLNFPS LEKIWDWNPL LESPKVCTSF K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-534519019165NO APICAL MERISTEM PROTEIN
1ut4_B2e-534519019165NO APICAL MERISTEM PROTEIN
1ut7_A2e-534519019165NO APICAL MERISTEM PROTEIN
1ut7_B2e-534519019165NO APICAL MERISTEM PROTEIN
3swm_A2e-534519022168NAC domain-containing protein 19
3swm_B2e-534519022168NAC domain-containing protein 19
3swm_C2e-534519022168NAC domain-containing protein 19
3swm_D2e-534519022168NAC domain-containing protein 19
3swp_A2e-534519022168NAC domain-containing protein 19
3swp_B2e-534519022168NAC domain-containing protein 19
3swp_C2e-534519022168NAC domain-containing protein 19
3swp_D2e-534519022168NAC domain-containing protein 19
4dul_A2e-534519019165NAC domain-containing protein 19
4dul_B2e-534519019165NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6720690.0AY672069.1 Hordeum vulgare subsp. vulgare NAC transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003571314.20.0PREDICTED: transcription factor JUNGBRUNNEN 1-like
TrEMBLM0VUG10.0M0VUG1_HORVD; Uncharacterized protein
STRINGMLOC_37364.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP77063650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.23e-93NAC domain containing protein 35